LRP5L (NM_182492) Human Mass Spec Standard
CAT#: PH311399
LRP5L MS Standard C13 and N15-labeled recombinant protein (NP_872298)
View other "LRP5L" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | LRP5L MS Standard C13 and N15-labeled recombinant protein (NP_872298) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC211399 |
| Predicted MW | 28.3 kDa |
| Protein Sequence |
>RC211399 representing NM_182492
Red=Cloning site Green=Tags(s) MEGHVYWTDDEVWAIRRAYLDGSGAQTLINTKINDPDDIAVNWVARSLYWTHTGTEHIEVTCLNSTSHKI LVSEDMDEPRAIALHPEMGLTYWIDWGENPEIKRANLDRQELRVLVNASLGWPNGLALDLQEGKLYWGDA KTDKIEAISVDETKRQTLLKDKLPHIFRFTLLGDFIYWTAWQHHSIKRVHKVKANRDVIIDQLPDLMGLK AVNVDKVVGTNPHADRNGGAATCASSRPTQPGLAAPSRAWNC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_872298 |
| RefSeq Size | 3601 |
| RefSeq ORF | 756 |
| Synonyms | DKFZp434O0213 |
| Locus ID | 91355 |
| Cytogenetics | 22q11.23 |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405514 | LRP5L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427704 | LRP5L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405514 | Transient overexpression lysate of low density lipoprotein receptor-related protein 5-like (LRP5L), transcript variant 1 |
CNY 3080.00 |
|
| LY427704 | Transient overexpression lysate of low density lipoprotein receptor-related protein 5-like (LRP5L), transcript variant 2 |
CNY 3080.00 |
|
| TP311399 | Recombinant protein of human low density lipoprotein receptor-related protein 5-like (LRP5L), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP760928 | Purified recombinant protein of Human low density lipoprotein receptor-related protein 5-like (LRP5L), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
