MBD3L1 (NM_145208) Human Mass Spec Standard
CAT#: PH311313
MBD3L1 MS Standard C13 and N15-labeled recombinant protein (NP_660209)
View other "MBD3L1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | MBD3L1 MS Standard C13 and N15-labeled recombinant protein (NP_660209) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211313 |
Predicted MW | 21.6 kDa |
Protein Sequence |
>RC211313 protein sequence
Red=Cloning site Green=Tags(s) MAKSSQRKQRDCVNQCKSKPGLSTSIPLRMSSYTFKRPVTRITPHPGNEVRYHQWEESLEKPQQVCWQRR LQGLQAYSSAGELSSTLDLANTLQKLVPSYTGGSLLEDLASGLEHSCPMPHLACSSDAVEIIPAEGVGIS QLLCKQFLVTEEDIRKQEGKVKTVRERLAIALIADGLANEAEKVRDQEGCPEKR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_660209 |
RefSeq Size | 748 |
RefSeq ORF | 582 |
Synonyms | MBD3L |
Locus ID | 85509 |
Cytogenetics | 19p13.2 |
Summary | This gene encodes a protein that is related to methyl-CpG-binding proteins but lacks the methyl-CpG binding domain. The protein is localized to discrete areas in the nucleus, and expression appears to be restricted to round spermatids, suggesting that the protein plays a role in the postmeiotic stages of male germ cell development. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407947 | MBD3L1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407947 | Transient overexpression lysate of methyl-CpG binding domain protein 3-like 1 (MBD3L1) |
CNY 3080.00 |
|
TP311313 | Recombinant protein of human methyl-CpG binding domain protein 3-like 1 (MBD3L1), 20 µg |
CNY 2900.00 |