CAMK2N2 (NM_033259) Human Mass Spec Standard
CAT#: PH311256
CAMK2N2 MS Standard C13 and N15-labeled recombinant protein (NP_150284)
View other "CAMK2N2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
Product Data | |
Description | CAMK2N2 MS Standard C13 and N15-labeled recombinant protein (NP_150284) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211256 |
Predicted MW | 8.7 kDa |
Protein Sequence |
>RC211256 protein sequence
Red=Cloning site Green=Tags(s) MSEILPYSEDKMGRFGADPEGSDLSFSCRLQDTNSFFAGNQAKRPPKLGQIGRAKRVVIEDDRIDDVLKG MGEKPPSGV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_150284 |
RefSeq Size | 1360 |
RefSeq ORF | 237 |
Synonyms | CAM-KIIN; CAMKIIN |
Locus ID | 94032 |
Cytogenetics | 3q27.1 |
Summary | This gene encodes a protein that is highly similar to the rat CaM-KII inhibitory protein, an inhibitor of calcium/calmodulin-dependent protein kinase II (CAMKII). CAMKII regulates numerous physiological functions, including neuronal synaptic plasticity through the phosphorylation of alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid-type glutamate (AMPA) receptors. Studies of the similar protein in rat suggest that this protein may function as a negative regulator of CaM-KII and may act to inhibit the phosphorylation of AMPA receptors. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409633 | CAMK2N2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409633 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II inhibitor 2 (CAMK2N2) |
CNY 3080.00 |
|
TP311256 | Recombinant protein of human calcium/calmodulin-dependent protein kinase II inhibitor 2 (CAMK2N2), 20 µg |
CNY 2900.00 |
其它CAMK2N2产品