Gemin 2 (GEMIN2) (NM_003616) Human Mass Spec Standard
CAT#: PH311219
SIP1 MS Standard C13 and N15-labeled recombinant protein (NP_003607)
View other "Gemin 2" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | SIP1 MS Standard C13 and N15-labeled recombinant protein (NP_003607) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211219 |
Predicted MW | 31.6 kDa |
Protein Sequence |
>RC211219 protein sequence
Red=Cloning site Green=Tags(s) MRRAELAGLKTMAWVPAESAVEELMPRLLPVEPCDLTEGFDPSVPPRTPQEYLRRVQIEAAQCPDVVVAQ IDPKKLKRKQSVNISLSGCQPAPEGYSPTLQWQQQQVAQFSTVRQNVNKHRSHWKSQQLDSNVTMPKSED EEGWKKFCLGEKLCADGAVGPATNESPGIDYVQIGFPPLLSIVSRMNQATVTSVLEYLSNWFGERDFTPE LGRWLYALLACLEKPLLPEAHSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003607 |
RefSeq Size | 1368 |
RefSeq ORF | 840 |
Synonyms | SIP1; SIP1-delta |
Locus ID | 8487 |
Cytogenetics | 14q21.1 |
Summary | This gene encodes one of the proteins found in the SMN complex, which consists of several gemin proteins and the protein known as the survival of motor neuron protein. The SMN complex is localized to a subnuclear compartment called gems (gemini of coiled bodies) and is required for assembly of spliceosomal snRNPs and for pre-mRNA splicing. This protein interacts directly with the survival of motor neuron protein and it is required for formation of the SMN complex. A knockout mouse targeting the mouse homolog of this gene exhibited disrupted snRNP assembly and motor neuron degeneration. [provided by RefSeq, Aug 2011] |
Protein Families | Druggable Genome, Stem cell - Pluripotency |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418547 | GEMIN2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422905 | GEMIN2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418547 | Transient overexpression lysate of survival of motor neuron protein interacting protein 1 (SIP1), transcript variant alpha |
CNY 3080.00 |
|
LY422905 | Transient overexpression lysate of survival of motor neuron protein interacting protein 1 (SIP1), transcript variant gamma |
CNY 3080.00 |
|
TP311219 | Recombinant protein of human survival of motor neuron protein interacting protein 1 (SIP1), transcript variant alpha, 20 µg |
CNY 2900.00 |
其它Gemin 2产品