WNT16 (NM_057168) Human Mass Spec Standard
CAT#: PH311204
WNT16 MS Standard C13 and N15-labeled recombinant protein (NP_476509)
View other "WNT16" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | WNT16 MS Standard C13 and N15-labeled recombinant protein (NP_476509) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC211204 |
| Predicted MW | 37.6 kDa |
| Protein Sequence |
>RC211204 representing NM_057168
Red=Cloning site Green=Tags(s) MDRAALLGLARLCALWAALLVLFPYGAQGNWMWLGIASFGVPEKLGCANLPLNSRQKELCKRKPYLLPSI REGARLGIQECGSQFRHERWNCMITAAATTAPMGASPLFGYELSSGTKETAFIYAVMAAGLVHSVTRSCS AGNMTECSCDTTLQNGGSASEGWHWGGCSDDVQYGMWFSRKFLDFPIGNTTGKENKVLLAMNLHNNEAGR QAVAKLMSVDCRCHGVSGSCAVKTCWKTMSSFEKIGHLLKDKYENSIQISDKTKRKMRRREKDQRKIPIH KDDLLYVNKSPNYCVEDKKLGIPGTQGRECNRTSEGADGCNLLCCGRGYNTHVVRHVERCECKFIWCCYV RCRRCESMTDVHTCK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_476509 |
| RefSeq Size | 3132 |
| RefSeq ORF | 1095 |
| Locus ID | 51384 |
| Cytogenetics | 7q31.31 |
| Summary | The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It contains two transcript variants diverging at the 5' termini. These two variants are proposed to be the products of separate promoters and not to be splice variants from a single promoter. They are differentially expressed in normal tissues, one of which (variant 2) is expressed at significant levels only in the pancreas, whereas another one (variant 1) is expressed more ubiquitously with highest levels in adult kidney, placenta, brain, heart, and spleen. [provided by RefSeq, Jul 2008] |
| Protein Families | Secreted Protein, Transmembrane |
| Protein Pathways | Basal cell carcinoma, Hedgehog signaling pathway, Melanogenesis, Pathways in cancer, Wnt signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409269 | WNT16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC414193 | WNT16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409269 | Transient overexpression lysate of wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 1 |
CNY 3080.00 |
|
| LY414193 | Transient overexpression lysate of wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 2 |
CNY 3080.00 |
|
| TP311204 | Purified recombinant protein of Homo sapiens wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 1, 20 µg |
CNY 2900.00 |
