TNFSF9 (NM_003811) Human Mass Spec Standard
CAT#: PH311160
TNFSF9 MS Standard C13 and N15-labeled recombinant protein (NP_003802)
View other "TNFSF9" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | TNFSF9 MS Standard C13 and N15-labeled recombinant protein (NP_003802) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC211160 |
| Predicted MW | 26.6 kDa |
| Protein Sequence |
>RC211160 protein sequence
Red=Cloning site Green=Tags(s) MEYASDASLDPEAPWPPAPRARACRVLPWALVAGLLLLLLLAAACAVFLACPWAVSGARASPGSAASPRL REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGV YYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQ RLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003802 |
| RefSeq Size | 1680 |
| RefSeq ORF | 762 |
| Synonyms | 4-1BB-L; CD137L; TNLG5A |
| Locus ID | 8744 |
| Cytogenetics | 19p13.3 |
| Summary | The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This transmembrane cytokine is a bidirectional signal transducer that acts as a ligand for TNFRSF9/4-1BB, which is a costimulatory receptor molecule in T lymphocytes. This cytokine and its receptor are involved in the antigen presentation process and in the generation of cytotoxic T cells. The receptor TNFRSF9/4-1BB is absent from resting T lymphocytes but rapidly expressed upon antigenic stimulation. The ligand encoded by this gene, TNFSF9/4-1BBL, has been shown to reactivate anergic T lymphocytes in addition to promoting T lymphocyte proliferation. This cytokine has also been shown to be required for the optimal CD8 responses in CD8 T cells. This cytokine is expressed in carcinoma cell lines, and is thought to be involved in T cell-tumor cell interaction.[provided by RefSeq, Oct 2008] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Cytokine-cytokine receptor interaction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418412 | TNFSF9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418412 | Transient overexpression lysate of tumor necrosis factor (ligand) superfamily, member 9 (TNFSF9) |
CNY 3080.00 |
|
| TP311160 | Recombinant protein of human tumor necrosis factor (ligand) superfamily, member 9 (TNFSF9), 20 µg |
CNY 2900.00 |
|
| TP700282 | Purified recombinant protein of human tumor necrosis factor (ligand) superfamily, member 9 (TNFSF9), with C-terminal Fc tag, expressed in human cells, 20 µg |
CNY 6650.00 |
|
| TP721145 | Purified recombinant protein of Human tumor necrosis factor (ligand) superfamily, member 9 (TNFSF9) |
CNY 1800.00 |
|
| TP723968 | Human 4-1BB Ligand Protein, mFc-His Tag |
CNY 4925.00 |
