MCEMP1 (NM_174918) Human Mass Spec Standard
CAT#: PH311156
C19orf59 MS Standard C13 and N15-labeled recombinant protein (NP_777578)
View other "MCEMP1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
| Product Data | |
| Description | C19orf59 MS Standard C13 and N15-labeled recombinant protein (NP_777578) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC211156 |
| Predicted MW | 21.2 kDa |
| Protein Sequence |
>RC211156 protein sequence
Red=Cloning site Green=Tags(s) MEVEEIYKHQEVKMQAPAFRDKKQGVSAKNQGAHDPDYENITLAFKNQDHAKGGHSRPTSQVPAQCRPPS DSTQVPCWLYRAILSLYILLALAFVLCIILSAFIMVKNAEMSKELLGFKRELWNVSNSVQACEERQKRGW DSVQQSITMVRSKIDRLETTLAGIKNIDTKVQKILEVLQKMPQSSPQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_777578 |
| RefSeq Size | 1326 |
| RefSeq ORF | 561 |
| Synonyms | C19orf59 |
| Locus ID | 199675 |
| Cytogenetics | 19p13.2 |
| Summary | This gene encodes a single-pass transmembrane protein. Based on its expression pattern, it is speculated to be involved in regulating mast cell differentiation or immune responses. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406400 | MCEMP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406400 | Transient overexpression lysate of chromosome 19 open reading frame 59 (C19orf59) |
CNY 3080.00 |
|
| TP311156 | Recombinant protein of human chromosome 19 open reading frame 59 (C19orf59), 20 µg |
CNY 2900.00 |
