NECAP1 (NM_015509) Human Mass Spec Standard
CAT#: PH311100
NECAP1 MS Standard C13 and N15-labeled recombinant protein (NP_056324)
View other "NECAP1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
| Product Data | |
| Description | NECAP1 MS Standard C13 and N15-labeled recombinant protein (NP_056324) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC211100 |
| Predicted MW | 29.7 kDa |
| Protein Sequence |
>RC211100 protein sequence
Red=Cloning site Green=Tags(s) MATELEYESVLCVKPDVSVYRIPPRASNRGYRASDWKLDQPDWTGRLRITSKGKTAYIKLEDKVSGELFA QAPVEQYPGIAVETVTDSSRYFVIRIQDGTGRSAFIGIGFTDRGDAFDFNVSLQDHFKWVKQESEISKES QEMDARPKLDLGFKEGQTIKLCIGNITNKKGGASKPRTARGGGLSLLPPPPGGKVTIPPPSSSVAISNHV TPPPIPKSNHGGSDADILLDLDSPAPVTTPAPTPVSVSNDLWGDFSTASSSVPNQAPQPSNWVQF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_056324 |
| RefSeq Size | 2600 |
| RefSeq ORF | 825 |
| Synonyms | DEE21; EIEE21 |
| Locus ID | 25977 |
| Cytogenetics | 12p13.31 |
| Summary | This gene encodes a protein containing two characteristic WXXF motifs. The encoded protein localizes to clathrin-coated vesicles, where it binds components of the adapter protein complexes and aids in endocytosis. Loss of function of this gene results in early infantile epileptic encephalopathy-21. There is a pseudogene for this gene on chromosome 7. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2014] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414502 | NECAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414502 | Transient overexpression lysate of NECAP endocytosis associated 1 (NECAP1), transcript variant 1 |
CNY 3080.00 |
|
| TP311100 | Recombinant protein of human NECAP endocytosis associated 1 (NECAP1), transcript variant 1, 20 µg |
CNY 2900.00 |

