H2BC18 (NM_001024599) Human Mass Spec Standard
CAT#: PH311042
HIST2H2BF MS Standard C13 and N15-labeled recombinant protein (NP_001019770)
View other "H2BC18" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | HIST2H2BF MS Standard C13 and N15-labeled recombinant protein (NP_001019770) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC211042 |
| Predicted MW | 13.9 kDa |
| Protein Sequence |
>RC211042 protein sequence
Red=Cloning site Green=Tags(s) MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDI FERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001019770 |
| RefSeq Size | 495 |
| RefSeq ORF | 378 |
| Synonyms | HIST2H2BF |
| Locus ID | 440689 |
| Cytogenetics | 1q21.2 |
| Summary | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-dependent histone that is a member of the histone H2B family and is found in a histone cluster on chromosome 1. [provided by RefSeq, Aug 2015] |
| Protein Pathways | Systemic lupus erythematosus |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC422516 | HIST2H2BF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY422516 | Transient overexpression lysate of histone cluster 2, H2bf (HIST2H2BF), transcript variant 1 |
CNY 3080.00 |
|
| TP311042 | Recombinant protein of human histone cluster 2, H2bf (HIST2H2BF), 20 µg |
CNY 2900.00 |
