VAX1 (NM_199131) Human Mass Spec Standard
CAT#: PH310985
VAX1 MS Standard C13 and N15-labeled recombinant protein (NP_954582)
View other "VAX1" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | VAX1 MS Standard C13 and N15-labeled recombinant protein (NP_954582) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210985 |
Predicted MW | 21 kDa |
Protein Sequence |
>RC210985 protein sequence
Red=Cloning site Green=Tags(s) MFGKPDKMDVRCHSDAEAARVSKNAHKESRESKGAEGNLPAAFLKEPQGAFSASGAAEDCNKSKSNSAAD PDYCRRILVRDAKGSIREIILPKGLDLDRPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLS ETQANSEENNERFKRGIKKQKKKRKKEPANDESRRGDSGGRGWQPL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_954582 |
RefSeq Size | 4494 |
RefSeq ORF | 558 |
Synonyms | MCOPS11 |
Locus ID | 11023 |
Cytogenetics | 10q25.3 |
Summary | This gene encodes a homeo-domain containing protein from a class of homeobox transcription factors which are conserved in vertebrates. Genes of this family are involved in the regulation of body development and morphogenesis. The most conserved genes, called HOX genes are found in special gene clusters. This gene belongs to the VAX subfamily and lies in the vicinity of the EMX homeobox gene family. Another member of VAX family is located on chromosome 2. The encoded protein may play an important role in the development of anterior ventral forebrain and visual system. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404744 | VAX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426368 | VAX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404744 | Transient overexpression lysate of ventral anterior homeobox 1 (VAX1), transcript variant 2 |
CNY 3080.00 |
|
LY426368 | Transient overexpression lysate of ventral anterior homeobox 1 (VAX1), transcript variant 1 |
CNY 3080.00 |
|
TP310985 | Recombinant protein of human ventral anterior homeobox 1 (VAX1), transcript variant 2, 20 µg |
CNY 2900.00 |