CACNG5 (NM_145811) Human Mass Spec Standard
CAT#: PH310953
CACNG5 MS Standard C13 and N15-labeled recombinant protein (NP_665810)
View other "CACNG5" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | CACNG5 MS Standard C13 and N15-labeled recombinant protein (NP_665810) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210953 |
Predicted MW | 30.9 kDa |
Protein Sequence |
>RC210953 protein sequence
Red=Cloning site Green=Tags(s) MSACGRKALTLLSSVFAVCGLGLLGIAVSTDYWLYLEEGVIVPQNQSTEIKMSLHSGLWRVCFLAGEERG RCFTIEYVMPMNTQLTSESTVNVLKMIRSATPFPLVSLFFMFIGFILNNIGHIRPHRTILAFVSGIFFIL SGLSLVVGLVLYISSINDEMLNRTKDAETYFNYKYGWSFAFAAISFLLTESAGVMSVYLFMKRYTAEDMY RPHPGFYRPRLSNCSDYSGQFLHPDAWVRGRSPSDISSEASLQMNSNYPALLKCPDYDQMSSSPC myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_665810 |
RefSeq Size | 926 |
RefSeq ORF | 825 |
Locus ID | 27091 |
Cytogenetics | 17q24.2 |
Summary | The protein encoded by this gene is a type II transmembrane AMPA receptor regulatory protein (TARP). TARPs regulate both trafficking and channel gating of the AMPA receptors. This gene is part of a functionally diverse eight-member protein subfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two family members, a type I TARP and a calcium channel gamma subunit. This gene is a susceptibility locus for schizophrenia and bipolar disorder. [provided by RefSeq, Dec 2010] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Arrhythmogenic right ventricular cardiomyopathy (ARVC), Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM), MAPK signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407551 | CACNG5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407551 | Transient overexpression lysate of calcium channel, voltage-dependent, gamma subunit 5 (CACNG5), transcript variant 1 |
CNY 3080.00 |
|
TP310953 | Recombinant protein of human calcium channel, voltage-dependent, gamma subunit 5 (CACNG5), transcript variant 1, 20 µg |
CNY 2900.00 |