GATA4 (NM_002052) Human Mass Spec Standard
CAT#: PH310945
GATA4 MS Standard C13 and N15-labeled recombinant protein (NP_002043)
View other "GATA4" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | GATA4 MS Standard C13 and N15-labeled recombinant protein (NP_002043) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210945 |
| Predicted MW | 44.6 kDa |
| Protein Sequence |
>RC210945 protein sequence
Red=Cloning site Green=Tags(s) MYQSLAMAANHGPPPGAYEAGGPGAFMHGAGAASSPVYVPTPRVPSSVLGLSYLQGGGAGSASGGASGGS SGGAASGAGPGTQQGSPGWSQAGADGAAYTPPPVSPRFSFPGTTGSLAAAAAAAAAREAAAYSSGGGAAG AGLAGREQYGRAGFAGSYSSPYPAYMADVGASWAAAAAASAGPFDSPVLHSLPGRANPAARHPNLDMFDD FSEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSASRRVGLSCANCQTTTTT LWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTRKRKPKNLNKSKTPAAPSGSESLPPASGASSNS SNATTSSSEEMRPIKTEPGLSSHYGHSSSVSQTFSVSAMSGHGPSIHPVLSALKLSPQGYASPVSQSPQT SSKQDSWNSLVLADSHGDIITA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002043 |
| RefSeq Size | 3419 |
| RefSeq ORF | 1326 |
| Synonyms | ASD2; TACHD; TOF; VSD1 |
| Locus ID | 2626 |
| Cytogenetics | 8p23.1 |
| Summary | This gene encodes a member of the GATA family of zinc-finger transcription factors. Members of this family recognize the GATA motif which is present in the promoters of many genes. This protein is thought to regulate genes involved in embryogenesis and in myocardial differentiation and function, and is necessary for normal testicular development. Mutations in this gene have been associated with cardiac septal defects. Additionally, alterations in gene expression have been associated with several cancer types. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2015] |
| Protein Families | Embryonic stem cells, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419558 | GATA4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419558 | Transient overexpression lysate of GATA binding protein 4 (GATA4) |
CNY 3080.00 |
|
| TP310945 | Recombinant protein of human GATA binding protein 4 (GATA4), 20 µg |
CNY 2900.00 |


