PBX1 (NM_002585) Human Mass Spec Standard
CAT#: PH310944
PBX1 MS Standard C13 and N15-labeled recombinant protein (NP_002576)
View other "PBX1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | PBX1 MS Standard C13 and N15-labeled recombinant protein (NP_002576) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210944 |
| Predicted MW | 46.6 kDa |
| Protein Sequence |
>RC210944 protein sequence
Red=Cloning site Green=Tags(s) MDEQPRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDEAQARKHALNC HRMKPALFNVLCEIKEKTVLSIRGAQEEEPTDPQLMRLDNMLLAEGVAGPEKGGGSAAAAAAAAASGGAG SDNSVEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVSIIHRKFSS IQMQLKQSTCEAVMILRSRFLDARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQV SNWFGNKRIRYKKNIGKFQEEANIYAAKTAVTATNVSAHGSQANSPSTPNSAGSSSSFNMSNSGDLFMSV QSLNGDSYQGAQVGANVQSQVDTLRHVISQTGGYSDGLAASQMYSPQGISANGGWQDATTPSSVTSPTEG PGSVHSDTSN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002576 |
| RefSeq Size | 6918 |
| RefSeq ORF | 1290 |
| Synonyms | CAKUHED |
| Locus ID | 5087 |
| Cytogenetics | 1q23.3 |
| Summary | This gene encodes a nuclear protein that belongs to the PBX homeobox family of transcriptional factors. Studies in mice suggest that this gene may be involved in the regulation of osteogenesis and required for skeletal patterning and programming. A chromosomal translocation, t(1;19) involving this gene and TCF3/E2A gene, is associated with pre-B-cell acute lymphoblastic leukemia. The resulting fusion protein, in which the DNA binding domain of E2A is replaced by the DNA binding domain of this protein, transforms cells by constitutively activating transcription of genes regulated by the PBX protein family. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2017] |
| Protein Families | Druggable Genome, Stem cell - Pluripotency, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400918 | PBX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400918 | Transient overexpression lysate of pre-B-cell leukemia homeobox 1 (PBX1) |
CNY 3080.00 |
|
| TP310944 | Recombinant protein of human pre-B-cell leukemia homeobox 1 (PBX1), 20 µg |
CNY 2900.00 |
