GIRK2 (KCNJ6) (NM_002240) Human Mass Spec Standard
CAT#: PH310938
KCNJ6 MS Standard C13 and N15-labeled recombinant protein (NP_002231)
View other "GIRK2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | KCNJ6 MS Standard C13 and N15-labeled recombinant protein (NP_002231) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210938 |
| Predicted MW | 48.5 kDa |
| Protein Sequence |
>RC210938 protein sequence
Red=Cloning site Green=Tags(s) MAKLTESMTNVLEGDSMDQDVESPVAIHQPKLPKQARDDLPRHISRDRTKRKIQRYVRKDGKCNVHHGNV RETYRYLTDIFTTLVDLKWRFNLLIFVMVYTVTWLFFGMIWWLIAYIRGDMDHIEDPSWTPCVTNLNGFV SAFLFSIETETTIGYGYRVITDKCPEGIILLLIQSVLGSIVNAFMVGCMFVKISQPKKRAETLVFSTHAV ISMRDGKLCLMFRVGDLRNSHIVEASIRAKLIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIIS HEINQQSPFWEISKAQLPKEELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVD YNSFHETYETSTPSLSAKELAELASRAELPLSWSVSSKLNQHAELETEEEEKNLEEQTERNGDVANLENE SKV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002231 |
| RefSeq Size | 2537 |
| RefSeq ORF | 1269 |
| Synonyms | BIR1; GIRK-2; GIRK2; hiGIRK2; KATP-2; KATP2; KCNJ7; KIR3.2; KPLBS |
| Locus ID | 3763 |
| Cytogenetics | 21q22.13 |
| Summary | This gene encodes a member of the G protein-coupled inwardly-rectifying potassium channel family of inward rectifier potassium channels. This type of potassium channel allows a greater flow of potassium into the cell than out of it. These proteins modulate many physiological processes, including heart rate in cardiac cells and circuit activity in neuronal cells, through G-protein coupled receptor stimulation. Mutations in this gene are associated with Keppen-Lubinsky Syndrome, a rare condition characterized by severe developmental delay, facial dysmorphism, and intellectual disability. [provided by RefSeq, Apr 2015] |
| Protein Families | Druggable Genome, Ion Channels: Potassium, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400812 | KCNJ6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400812 | Transient overexpression lysate of potassium inwardly-rectifying channel, subfamily J, member 6 (KCNJ6) |
CNY 3080.00 |
|
| TP310938 | Recombinant protein of human potassium inwardly-rectifying channel, subfamily J, member 6 (KCNJ6), 20 µg |
CNY 2900.00 |
