ERP29 (NM_006817) Human Mass Spec Standard
CAT#: PH310918
ERP29 MS Standard C13 and N15-labeled recombinant protein (NP_006808)
View other "ERP29" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | ERP29 MS Standard C13 and N15-labeled recombinant protein (NP_006808) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210918 |
| Predicted MW | 29 kDa |
| Protein Sequence |
>RC210918 protein sequence
Red=Cloning site Green=Tags(s) MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQ DEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGA IQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKIL DQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAFQKKGAEKEEL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_006808 |
| RefSeq Size | 1472 |
| RefSeq ORF | 783 |
| Synonyms | C12orf8; ERp28; ERp31; HEL-S-107; PDI-DB; PDIA9 |
| Locus ID | 10961 |
| Cytogenetics | 12q24.13 |
| Summary | This gene encodes a protein which localizes to the lumen of the endoplasmic reticulum (ER). It is a member of the protein disulfide isomerase (PDI) protein family but lacks an active thioredoxin motif, suggesting that this protein does not function as a disulfide isomerase. The canonical protein dimerizes and is thought to play a role in the processing of secretory proteins within the ER. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2016] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402039 | ERP29 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402039 | Transient overexpression lysate of endoplasmic reticulum protein 29 (ERP29), transcript variant 1 |
CNY 3080.00 |
|
| TP310918 | Recombinant protein of human endoplasmic reticulum protein 29 (ERP29), transcript variant 1, 20 µg |
CNY 2900.00 |
