PDE4 (PDE4B) (NM_001037341) Human Mass Spec Standard
CAT#: PH310912
PDE4B MS Standard C13 and N15-labeled recombinant protein (NP_001032418)
View other "PDE4" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 4840.00
Specifications
| Product Data | |
| Description | PDE4B MS Standard C13 and N15-labeled recombinant protein (NP_001032418) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210912 |
| Predicted MW | 83.3 kDa |
| Protein Sequence |
>RC210912 protein sequence
Red=Cloning site Green=Tags(s) MKKSRSVMTVMADDNVKDYFECSLSKSYSSSSNTLGIDLWRGRRCCSGNLQLPPLSQRQSERARTPEGDG ISRPTTLPLTTLPSIAITTVSQECFDVENGPSPGRSPLDPQASSSAGLVLHATFPGHSQRRESFLYRSDS DYDLSPKAMSRNSSLPSEQHGDDLIVTPFAQVLASLRSVRNNFTILTNLHGTSNKRSPAASQPPVSRVNP QEESYQKLAMETLEELDWCLDQLETIQTYRSVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTFL DKQNDVEIPSPTQKDREKKKKQQLMTQISGVKKLMHSSSLNNTSISRFGVNTENEDHLAKELEDLNKWGL NIFNVAGYSHNRPLTCIMYAIFQERDLLKTFRISSDTFITYMMTLEDHYHSDVAYHNSLHAADVAQSTHV LLSTPALDAVFTDLEILAAIFAAAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHLAVGFKLLQEE HCDIFMNLTKKQRQTLRKMVIDMVLATDMSKHMSLLADLKTMVETKKVTSSGVLLLDNYTDRIQVLRNMV HCADLSNPTKSLELYRQWTDRIMEEFFQQGDKERERGMEISPMCDKHTASVEKSQVGFIDYIVHPLWETW ADLVQPDAQDILDTLEDNRNWYQSMIPQSPSPPLDEQNRDCQGLMEKFQFELTLDEEDSEGPEKEGEGHS YFSSTKTLCVIDPENRDSLGETDIDIATEDKSPVDT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001032418 |
| RefSeq Size | 4309 |
| RefSeq ORF | 2208 |
| Synonyms | DPDE4; PDEIVB |
| Locus ID | 5142 |
| Cytogenetics | 1p31.3 |
| Summary | This gene is a member of the type IV, cyclic AMP (cAMP)-specific, cyclic nucleotide phosphodiesterase (PDE) family. The encoded protein regulates the cellular concentrations of cyclic nucleotides and thereby play a role in signal transduction. Altered activity of this protein has been associated with schizophrenia and bipolar affective disorder. Alternative splicing and the use of alternative promoters results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2014] |
| Protein Families | Druggable Genome |
| Protein Pathways | Progesterone-mediated oocyte maturation, Purine metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400417 | PDE4B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC400919 | PDE4B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC421908 | PDE4B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400417 | Transient overexpression lysate of phosphodiesterase 4B, cAMP-specific (phosphodiesterase E4 dunce homolog, Drosophila) (PDE4B), transcript variant b |
CNY 4840.00 |
|
| LY400919 | Transient overexpression lysate of phosphodiesterase 4B, cAMP-specific (phosphodiesterase E4 dunce homolog, Drosophila) (PDE4B), transcript variant a |
CNY 4840.00 |
|
| LY421908 | Transient overexpression lysate of phosphodiesterase 4B, cAMP-specific (phosphodiesterase E4 dunce homolog, Drosophila) (PDE4B), transcript variant d |
CNY 3080.00 |
|
| PH311956 | PDE4B MS Standard C13 and N15-labeled recombinant protein (NP_002591) |
CNY 19520.00 |
|
| TP310912 | Recombinant protein of human phosphodiesterase 4B, cAMP-specific (phosphodiesterase E4 dunce homolog, Drosophila) (PDE4B), transcript variant d, 20 µg |
CNY 2900.00 |
|
| TP311956 | Recombinant protein of human phosphodiesterase 4B, cAMP-specific (phosphodiesterase E4 dunce homolog, Drosophila) (PDE4B), transcript variant a, 20 µg |
CNY 2900.00 |
