Macrophage Inflammatory Protein 3 (CCL23) (NM_145898) Human Mass Spec Standard
CAT#: PH310897
CCL23 MS Standard C13 and N15-labeled recombinant protein (NP_665905)
View other "Macrophage Inflammatory Protein 3" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | CCL23 MS Standard C13 and N15-labeled recombinant protein (NP_665905) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210897 |
Predicted MW | 13.4 kDa |
Protein Sequence |
>RC210897 protein sequence
Red=Cloning site Green=Tags(s) MKVSVAALSCLMLVTALGSQARVTKDAETEFMMSKLPLENPVLLDRFHATSADCCISYTPRSIPCSLLES YFETNSECSKPGVIFLTKKGRRFCANPSDKQVQVCMRMLKLDTRIKTRKN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_665905 |
RefSeq Size | 604 |
RefSeq ORF | 360 |
Synonyms | CK-BETA-8; Ckb-8; Ckb-8-1; CKb8; hmrp-2a; MIP-3; MIP3; MPIF-1; SCYA23 |
Locus ID | 6368 |
Cytogenetics | 17q12 |
Summary | This gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CC subfamily, displays chemotactic activity on resting T lymphocytes and monocytes, lower activity on neutrophils and no activity on activated T lymphocytes. The protein is also a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line. In addition, the product of this gene is a potent agonist of the chemokine (C-C motif) receptor 1. Alternative splicing results in multiple transcript variants that encode different isoforms. [provided by RefSeq, Jul 2013] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407835 | CCL23 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407835 | Transient overexpression lysate of chemokine (C-C motif) ligand 23 (CCL23), transcript variant CKbeta8 |
CNY 3080.00 |
|
TP310897 | Recombinant protein of human chemokine (C-C motif) ligand 23 (CCL23), transcript variant CKbeta8, 20 µg |
CNY 2900.00 |
|
TP720600 | Purified recombinant protein of Human chemokine (C-C motif) ligand 23 (CCL23), transcript variant CKbeta8 |
CNY 1800.00 |
|
TP723836 | Purified recombinant protein of Human chemokine (C-C motif) ligand 23 (CCL23 / MPIF-1), transcript variant CKbeta8 |
CNY 4090.00 |
其它Macrophage Inflammatory Protein 3产品