S100A5 (NM_002962) Human Mass Spec Standard
CAT#: PH310891
S100A5 MS Standard C13 and N15-labeled recombinant protein (NP_002953)
View other "S100A5" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | S100A5 MS Standard C13 and N15-labeled recombinant protein (NP_002953) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210891 |
| Predicted MW | 12.8 kDa |
| Protein Sequence |
>RC210891 protein sequence
Red=Cloning site Green=Tags(s) MPAAWILWAHSHSELHTVMETPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELCLGEMKESSI DDLMKSLDKNSDQEIDFKEYSVFLTMLCMAYNDFFLEDNK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002953 |
| RefSeq Size | 710 |
| RefSeq ORF | 330 |
| Synonyms | S100D |
| Locus ID | 6276 |
| Cytogenetics | 1q21.3 |
| Summary | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein has a Ca2+ affinity 20- to 100-fold higher than the other S100 proteins studied under identical conditions. This protein also binds Zn2+ and Cu2+, and Cu2+ strongly which impairs the binding of Ca2+. This protein is expressed in very restricted regions of the adult brain. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418992 | S100A5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418992 | Transient overexpression lysate of S100 calcium binding protein A5 (S100A5) |
CNY 3080.00 |
|
| TP310891 | Recombinant protein of human S100 calcium binding protein A5 (S100A5), 20 µg |
CNY 2900.00 |
