RNF122 (NM_024787) Human Mass Spec Standard
CAT#: PH310868
RNF122 MS Standard C13 and N15-labeled recombinant protein (NP_079063)
View other "RNF122" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | RNF122 MS Standard C13 and N15-labeled recombinant protein (NP_079063) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210868 |
Predicted MW | 17.5 kDa |
Protein Sequence |
>RC210868 protein sequence
Red=Cloning site Green=Tags(s) MHPFQWCNGCFCGLGLVSTNKSCSMPPISFQDLPLNIYMVIFGTGIFVFMLSLIFCCYFISKLRNQAQSE RYGYKEVVLKGDAKKLQLYGQTCAVCLEDFKGKDELGVLPCQHAFHRKCLVKWLEVRCVCPMCNKPIASP SEATQNIGILLDELV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_079063 |
RefSeq Size | 1872 |
RefSeq ORF | 465 |
Locus ID | 79845 |
Cytogenetics | 8p12 |
Summary | The encoded protein contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. The encoded protein is localized to the endoplasmic reticulum and golgi apparatus, and may be associated with cell viability. [provided by RefSeq, Jul 2013] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411049 | RNF122 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411049 | Transient overexpression lysate of ring finger protein 122 (RNF122) |
CNY 3080.00 |
|
TP310868 | Recombinant protein of human ring finger protein 122 (RNF122), 20 µg |
CNY 2900.00 |