TMX3 (NM_019022) Human Mass Spec Standard
CAT#: PH310841
TMX3 MS Standard C13 and N15-labeled recombinant protein (NP_061895)
View other "TMX3" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | TMX3 MS Standard C13 and N15-labeled recombinant protein (NP_061895) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210841 |
| Predicted MW | 51.9 kDa |
| Protein Sequence |
>RC210841 protein sequence
Red=Cloning site Green=Tags(s) MAAWKSWTALRLCATVVVLDMVVCKGFVEDLDESFKENRNDDIWLVDFYAPWCGHCKKLEPIWNEVGLEM KSIGSPVKVGKMDATSYSSIASEFGVRGYPTIKLLKGDLAYNYRGPRTKDDIIEFAHRVSGALIRPLPSQ QMFEHMQKRHRVFFVYVGGESPLKEKYIDAASELIVYTYFFSASEEVVPEYVTLKEMPAVLVFKDETYFV YDEYEDGDLSSWINRERFQNYLAMDGFLLYELGDTGKLVALAVIDEKNTSVEHTRLKSIIQEVARDYRDL FHRDFQFGHMDGNDYINTLLMDELTVPTVVVLNTSNQQYFLLDRQIKNVEDMVQFINNILDGTVEAQGGD SILQRLKRIVFDAKSTIVSIFKSSPLMGCFLFGLPLGVISIMCYGIYTADTDGGYIEERYEVSKSENENQ EQIEESKEQQEPSSGGSVVPTVQEPKDVLEKKKD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_061895 |
| RefSeq Size | 4767 |
| RefSeq ORF | 1362 |
| Synonyms | PDIA13; TXNDC10 |
| Locus ID | 54495 |
| Cytogenetics | 18q22.1 |
| Summary | This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The canonical protein encoded by this gene has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, one transmembrane domain and a C-terminal ER-retention sequence. This gene is expressed in many tissues but has its highest expression in heart and skeletal muscle. It is expressed in the retinal neuroepithelium and lens epithelium in the developing murine eye and haploinsufficiency of this gene in humans and zebrafish is associated with microphthalmia. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Apr 2017] |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412814 | TMX3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412814 | Transient overexpression lysate of thioredoxin-related transmembrane protein 3 (TMX3) |
CNY 3080.00 |
|
| TP310841 | Recombinant protein of human thioredoxin-related transmembrane protein 3 (TMX3), 20 µg |
CNY 2900.00 |
