MST1 (STK4) (NM_006282) Human Mass Spec Standard
CAT#: PH310831
STK4 MS Standard C13 and N15-labeled recombinant protein (NP_006273)
View other "MST1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | STK4 MS Standard C13 and N15-labeled recombinant protein (NP_006273) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210831 |
| Predicted MW | 55.6 kDa |
| Protein Sequence |
>RC210831 protein sequence
Red=Cloning site Green=Tags(s) METVQLRNPPRRQLKKLDEDSLTKQPEEVFDVLEKLGEGSYGSVYKAIHKETGQIVAIKQVPVESDLQEI IKEISIMQQCDSPHVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILQSTLKGLEYL HFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSL GITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDNFTDFVKQCLVKSPEQRATATQLLQHPF VRSAKGVSILRDLINEAMDVKLKRQESQQREVDQDDEENSEEDEMDSGTMVRAVGDEMGTVRVASTMTDG ANTMIEHDDTLPSQLGTMVINAEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEKENQINSFGKSVPGPLK NSSDWKIPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAKKRRQQNF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_006273 |
| RefSeq Size | 6344 |
| RefSeq ORF | 1461 |
| Synonyms | KRS2; MST1; YSK3 |
| Locus ID | 6789 |
| Cytogenetics | 20q13.12 |
| Summary | The protein encoded by this gene is a cytoplasmic kinase that is structurally similar to the yeast Ste20p kinase, which acts upstream of the stress-induced mitogen-activated protein kinase cascade. The encoded protein can phosphorylate myelin basic protein and undergoes autophosphorylation. A caspase-cleaved fragment of the encoded protein has been shown to be capable of phosphorylating histone H2B. The particular phosphorylation catalyzed by this protein has been correlated with apoptosis, and it's possible that this protein induces the chromatin condensation observed in this process. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Protein Kinase |
| Protein Pathways | MAPK signaling pathway, Non-small cell lung cancer, Pathways in cancer |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401893 | STK4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401893 | Transient overexpression lysate of serine/threonine kinase 4 (STK4) |
CNY 3080.00 |
|
| TP310831 | Recombinant protein of human serine/threonine kinase 4 (STK4), 20 µg |
CNY 2900.00 |
