RAB9B (NM_016370) Human Mass Spec Standard
CAT#: PH310826
RAB9B MS Standard C13 and N15-labeled recombinant protein (NP_057454)
View other "RAB9B" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | RAB9B MS Standard C13 and N15-labeled recombinant protein (NP_057454) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210826 |
| Predicted MW | 22.7 kDa |
| Protein Sequence |
>RC210826 protein sequence
Red=Cloning site Green=Tags(s) MSGKSLLLKVILLGDGGVGKSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQIWDTAGQERFK SLRTPFYRGADCCLLTFSVDDRQSFENLGNWQKEFIYYADVKDPEHFPFVVLGNKVDKEDRQVTTEEAQT WCMENGDYPYLETSAKDDTNVTVAFEEAVRQVLAVEEQLEHCMLGHTIDLNSGSKAGSSCC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057454 |
| RefSeq Size | 3799 |
| RefSeq ORF | 603 |
| Synonyms | Rab-9L; RAB9L |
| Locus ID | 51209 |
| Cytogenetics | Xq22.2 |
| Summary | This gene encodes a member of a subfamily of RAS small guanosine triphosphate (GTP)-binding proteins that regulate membrane trafficking. The encoded protein may be involved in endosome-to-Golgi transport. [provided by RefSeq, Jan 2010] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413988 | RAB9B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413988 | Transient overexpression lysate of RAB9B, member RAS oncogene family (RAB9B) |
CNY 3080.00 |
|
| TP310826 | Recombinant protein of human RAB9B, member RAS oncogene family (RAB9B), 20 µg |
CNY 2900.00 |
