NDUFC1 (NM_002494) Human Mass Spec Standard
CAT#: PH310771
NDUFC1 MS Standard C13 and N15-labeled recombinant protein (NP_002485)
View other "NDUFC1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | NDUFC1 MS Standard C13 and N15-labeled recombinant protein (NP_002485) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210771 |
| Predicted MW | 8.7 kDa |
| Protein Sequence |
>RC210771 protein sequence
Red=Cloning site Green=Tags(s) MAPSALLRPLSRLLAPARLPSGPSVRSKFYVREPPNAKPDWLKVGFTLGTTVFLWIYLIKQHNEDILEYK RRNGLE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002485 |
| RefSeq Size | 860 |
| RefSeq ORF | 228 |
| Synonyms | KFYI |
| Locus ID | 4717 |
| Cytogenetics | 4q31.1 |
| Summary | The encoded protein is a subunit of the NADH:ubiquinone oxidoreductase (complex I), the first enzyme complex in the electron transport chain located in the inner mitochondrial membrane. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2010] |
| Protein Pathways | Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419294 | NDUFC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419294 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 1, 6kDa (NDUFC1) |
CNY 3080.00 |
|
| TP310771 | Recombinant protein of human NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 1, 6kDa (NDUFC1), 20 µg |
CNY 2900.00 |

