COX19 (NM_001031617) Human Mass Spec Standard
CAT#: PH310770
COX19 MS Standard C13 and N15-labeled recombinant protein (NP_001026788)
View other "COX19" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | COX19 MS Standard C13 and N15-labeled recombinant protein (NP_001026788) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210770 |
Predicted MW | 10.4 kDa |
Protein Sequence |
>RC210770 protein sequence
Red=Cloning site Green=Tags(s) MSTAMNFGTKSFQPRPPDKGSFPLDHLGECKSFKEKFMKCLHNNNFENALCRKESKEYLECRMERKLMLQ EPLEKLGFGDLTSGKSEAKK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001026788 |
RefSeq Size | 4896 |
RefSeq ORF | 270 |
Locus ID | 90639 |
Cytogenetics | 7p22.3 |
Summary | COX19 encodes a cytochrome c oxidase (COX)-assembly protein. The S. cerevisiae Cox19 protein may play a role in metal transport to the mitochondrial intermembrane space and assembly of complex IV of the mitochondrial respiratory chain (Sacconi et al., 2005 [PubMed 16212937]).[supplied by OMIM, Mar 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422214 | COX19 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY422214 | Transient overexpression lysate of COX19 cytochrome c oxidase assembly homolog (S. cerevisiae) (COX19) |
CNY 3080.00 |
|
TP310770 | Recombinant protein of human COX19 cytochrome c oxidase assembly homolog (S. cerevisiae) (COX19), 20 µg |
CNY 2900.00 |