VPS26C (NM_006052) Human Mass Spec Standard
CAT#: PH310755
DSCR3 MS Standard C13 and N15-labeled recombinant protein (NP_006043)
View other "VPS26C" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | DSCR3 MS Standard C13 and N15-labeled recombinant protein (NP_006043) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210755 |
| Predicted MW | 33 kDa |
| Protein Sequence |
>RC210755 protein sequence
Red=Cloning site Green=Tags(s) MGTALDIKIKRANKVYHAGEVLSGVVVISSKDSVQHQGVSLTMEGTVNLQLSAKSVGVFEAFYNSVKPIQ IINSTIEMVKPGKFPSGKTEIPFEFPLHLKGNKVLYETYHGVFVNIQYTLRCDMKRSLLAKDLTKTCEFI VHSAPQKGKFTPSPVDFTITPETLQNVKERALLPKFLLRGHLNSTNCVITQPLTGELVVESSEAAIRSVE LQLVRVETCGCAEGYARDATEIQNIQIADGDVCRGLSVPIYMVFPRLFTCPTLETTNFKVEFEVNIVVLL HPDHLITENFPLKLCRI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_006043 |
| RefSeq Size | 3252 |
| RefSeq ORF | 891 |
| Synonyms | DCRA; DSCR3; DSCRA |
| Locus ID | 10311 |
| Cytogenetics | 21q22.13 |
| Summary | The region of chromosome 21 between genes CBR and ERG (CBR-ERG region), which spans 2.5 Mb on 21q22.2, has been defined by analysis of patients with partial trisomy 21. It contributes significantly to the pathogenesis of many characteristics of Down syndrome, including morphological features, hypotonia, and cognitive disability. The DSCR3 (Down syndrome critical region gene 3) gene is found in this region and is predictated to contain eight exons. DSCR3 is expressed in most tissues examined. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416904 | DSCR3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416904 | Transient overexpression lysate of Down syndrome critical region gene 3 (DSCR3) |
CNY 3080.00 |
|
| TP310755 | Recombinant protein of human Down syndrome critical region gene 3 (DSCR3), 20 µg |
CNY 2900.00 |

