Tartrate Resistant Acid Phosphatase (ACP5) (NM_001611) Human Mass Spec Standard
CAT#: PH310752
ACP5 MS Standard C13 and N15-labeled recombinant protein (NP_001602)
View other "Tartrate Resistant Acid Phosphatase" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | ACP5 MS Standard C13 and N15-labeled recombinant protein (NP_001602) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210752 |
| Predicted MW | 36.6 kDa |
| Protein Sequence |
>RC210752 protein sequence
Red=Cloning site Green=Tags(s) MDMWTALLILQALLLPSLADGATPALRFVAVGDWGGVPNAPFHTAREMANAKEIARTVQILGADFILSLG DNFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQIAYSKISKRWNFPSPFYRLH FKIPQTNVSVAIFMLDTVTLCGNSDDFLSQQPERPRDVKLARTQLSWLKKQLAAAREDYVLVAGHYPVWS IAEHGPTHCLVKQLRPLLATYGVTAYLCGHDHNLQYLQDENGVGYVLSGAGNFMDPSKRHQRKVPNGYLR FHYGTEDSLGGFAYVEISSKEMTVTYIEASGKSLFKTRLPRRARP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001602 |
| RefSeq Size | 1506 |
| RefSeq ORF | 975 |
| Synonyms | HPAP; TRACP5a; TRACP5b; TRAP; TrATPase |
| Locus ID | 54 |
| Cytogenetics | 19p13.2 |
| Summary | This gene encodes an iron containing glycoprotein which catalyzes the conversion of orthophosphoric monoester to alcohol and orthophosphate. It is the most basic of the acid phosphatases and is the only form not inhibited by L(+)-tartrate. [provided by RefSeq, Aug 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Lysosome, Riboflavin metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400607 | ACP5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426340 | ACP5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426341 | ACP5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426342 | ACP5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400607 | Transient overexpression lysate of acid phosphatase 5, tartrate resistant (ACP5), transcript variant 4 |
CNY 3080.00 |
|
| LY426340 | Transient overexpression lysate of acid phosphatase 5, tartrate resistant (ACP5), transcript variant 2 |
CNY 3080.00 |
|
| LY426341 | Transient overexpression lysate of acid phosphatase 5, tartrate resistant (ACP5), transcript variant 1 |
CNY 3080.00 |
|
| LY426342 | Transient overexpression lysate of acid phosphatase 5, tartrate resistant (ACP5), transcript variant 3 |
CNY 3080.00 |
|
| TP310752 | Recombinant protein of human acid phosphatase 5, tartrate resistant (ACP5), transcript variant 4, 20 µg |
CNY 2900.00 |
其它Tartrate Resistant Acid Phosphatase产品
