MAPRE1 (NM_012325) Human Mass Spec Standard
CAT#: PH310749
MAPRE1 MS Standard C13 and N15-labeled recombinant protein (NP_036457)
View other "MAPRE1" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | MAPRE1 MS Standard C13 and N15-labeled recombinant protein (NP_036457) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210749 |
| Predicted MW | 30 kDa |
| Protein Sequence |
>RC210749 protein sequence
Red=Cloning site Green=Tags(s) MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHE YIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKDYDPVAARQGQETAVAPS LVAPALNKPKKPLTSSSAAPQRPISTQRTAAAPKAGPGVVRKNPGVGNGDDEAAELMQQVNVLKLTVEDL EKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_036457 |
| RefSeq Size | 2640 |
| RefSeq ORF | 804 |
| Synonyms | EB1 |
| Locus ID | 22919 |
| Cytogenetics | 20q11.21 |
| Summary | The protein encoded by this gene was first identified by its binding to the APC protein which is often mutated in familial and sporadic forms of colorectal cancer. This protein localizes to microtubules, especially the growing ends, in interphase cells. During mitosis, the protein is associated with the centrosomes and spindle microtubules. The protein also associates with components of the dynactin complex and the intermediate chain of cytoplasmic dynein. Because of these associations, it is thought that this protein is involved in the regulation of microtubule structures and chromosome stability. This gene is a member of the RP/EB family. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402208 | MAPRE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402208 | Transient overexpression lysate of microtubule-associated protein, RP/EB family, member 1 (MAPRE1) |
CNY 3080.00 |
|
| TP310749 | Recombinant protein of human microtubule-associated protein, RP/EB family, member 1 (MAPRE1), 20 µg |
CNY 2900.00 |
|
| TP710361 | Purified recombinant protein of human microtubule-associated protein, RP/EB family, member 1 (MAPRE1), full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4020.00 |
