SERP1 (NM_014445) Human Mass Spec Standard
CAT#: PH310729
SERP1 MS Standard C13 and N15-labeled recombinant protein (NP_055260)
View other "SERP1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | SERP1 MS Standard C13 and N15-labeled recombinant protein (NP_055260) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210729 |
Predicted MW | 7.4 kDa |
Protein Sequence |
>RC210729 protein sequence
Red=Cloning site Green=Tags(s) MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQIIQSIRMGM myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_055260 |
RefSeq Size | 3181 |
RefSeq ORF | 198 |
Synonyms | RAMP4 |
Locus ID | 27230 |
Cytogenetics | 3q25.1 |
Summary | Interacts with target proteins during their translocation into the lumen of the endoplasmic reticulum. Protects unfolded target proteins against degradation during ER stress. May facilitate glycosylation of target proteins after termination of ER stress. May modulate the use of N-glycosylation sites on target proteins (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415270 | SERP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415270 | Transient overexpression lysate of stress-associated endoplasmic reticulum protein 1 (SERP1) |
CNY 3080.00 |
|
TP310729 | Recombinant protein of human stress-associated endoplasmic reticulum protein 1 (SERP1), 20 µg |
CNY 2900.00 |