RHBDD1 (NM_032276) Human Mass Spec Standard
CAT#: PH310708
RHBDD1 MS Standard C13 and N15-labeled recombinant protein (NP_115652)
View other "RHBDD1" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | RHBDD1 MS Standard C13 and N15-labeled recombinant protein (NP_115652) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210708 |
Predicted MW | 35.8 kDa |
Protein Sequence |
>RC210708 protein sequence
Red=Cloning site Green=Tags(s) MQRRSRGINTGLILLLSQIFHVGINNIPPVTLATLALNIWFFLNPQKPLYSSCLSVEKCYQQKDWQRLLL SPLHHADDWHLYFNMASMLWKGINLERRLGSRWFAYVITAFSVLTGVVYLLLQFAVAEFMDEPDFKRSCA VGFSGVLFALKVLNNHYCPGGFVNILGFPVPNRFACWVELVAIHLFSPGTSFAGHLAGILVGLMYTQGPL KKIMEACAGGFSSSVGYPGRQYYFNSSGSSGYQDYYPHGRPDHYEEAPRNYDTYTAGLSEEEQLERALQA SLWDRGNTRNSPPPYGFHLSPEEMRRQRLHRFDSQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_115652 |
RefSeq Size | 4868 |
RefSeq ORF | 945 |
Synonyms | RHBDL4; RRP4 |
Locus ID | 84236 |
Cytogenetics | 2q36.3 |
Summary | Intramembrane-cleaving serine protease that cleaves single transmembrane or multi-pass membrane proteins in the hydrophobic plane of the membrane, luminal loops and juxtamembrane regions. Involved in regulated intramembrane proteolysis and the subsequent release of functional polypeptides from their membrane anchors. Functional component of endoplasmic reticulum-associated degradation (ERAD) for misfolded membrane proteins. Required for the degradation process of some specific misfolded endoplasmic reticulum (ER) luminal proteins. Participates in the transfer of misfolded proteins from the ER to the cytosol, where they are destroyed by the proteasome in a ubiquitin-dependent manner. Functions in BIK, MPZ, PKD1, PTCRA, RHO, STEAP3 and TRAC processing. Involved in the regulation of exosomal secretion; inhibits the TSAP6-mediated secretion pathway. Involved in the regulation of apoptosis; modulates BIK-mediated apoptotic activity. Also plays a role in the regulation of spermatogenesis; inhibits apoptotic activity in spermatogonia.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410222 | RHBDD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432870 | RHBDD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410222 | Transient overexpression lysate of rhomboid domain containing 1 (RHBDD1), transcript variant 1 |
CNY 3080.00 |
|
LY432870 | Transient overexpression lysate of rhomboid domain containing 1 (RHBDD1), transcript variant 2 |
CNY 3080.00 |
|
TP310708 | Recombinant protein of human rhomboid domain containing 1 (RHBDD1), 20 µg |
CNY 2900.00 |