PRH2 (NM_005042) Human Mass Spec Standard
CAT#: PH310681
PRH2 MS Standard C13 and N15-labeled recombinant protein (NP_005033)
View other "PRH2" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | PRH2 MS Standard C13 and N15-labeled recombinant protein (NP_005033) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210681 |
Predicted MW | 17 kDa |
Protein Sequence |
>RC210681 protein sequence
Red=Cloning site Green=Tags(s) MLLILLSVALLAFSSAQDLDEDVSQEDVPLVISDGGDSEQFIDEERQGPPLGGQQSQPSAGDGNQDDGPQ QGPPQQGGQQQQGPPPPQGKPQGPPQQGGHPPPPQGRPQGPPQQGGHPRPPRGRPQGPPQQGGHQQGPPP PPPGKPQGPPPQGGRPQGPPQGQSPQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005033 |
RefSeq Size | 4323 |
RefSeq ORF | 498 |
Synonyms | db-s; pa; PIF-S; Pr; pr1/Pr2; PRH1; PRP-1/PRP-2 |
Locus ID | 5555 |
Cytogenetics | 12p13.2 |
Summary | This gene encodes a member of the heterogeneous family of proline-rich salivary glycoproteins. The encoded preproprotein undergoes proteolytic processing to generate one or more mature isoforms before secretion from the parotid and submandibular/sublingual glands. In western population this locus is commonly biallelic and encodes proline-rich protein (PRP) isoforms, PRP-1 and PRP-2. The reference genome encodes the PRP-1 allele. Certain alleles of this gene are associated with susceptibility to dental caries. This gene is located in a cluster of closely related salivary proline-rich proteins on chromosome 12. [provided by RefSeq, Oct 2015] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417567 | PRH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426314 | PRH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417567 | Transient overexpression lysate of proline-rich protein HaeIII subfamily 2 (PRH2), transcript variant 1 |
CNY 3080.00 |
|
LY426314 | Transient overexpression lysate of proline-rich protein HaeIII subfamily 2 (PRH2), transcript variant 2 |
CNY 3080.00 |
|
TP310681 | Recombinant protein of human proline-rich protein HaeIII subfamily 2 (PRH2), transcript variant 1, 20 µg |
CNY 2900.00 |