PRH2 (NM_005042) Human Mass Spec Standard
CAT#: PH310681
PRH2 MS Standard C13 and N15-labeled recombinant protein (NP_005033)
View other "PRH2" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PRH2 MS Standard C13 and N15-labeled recombinant protein (NP_005033) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210681 |
| Predicted MW | 17 kDa |
| Protein Sequence |
>RC210681 protein sequence
Red=Cloning site Green=Tags(s) MLLILLSVALLAFSSAQDLDEDVSQEDVPLVISDGGDSEQFIDEERQGPPLGGQQSQPSAGDGNQDDGPQ QGPPQQGGQQQQGPPPPQGKPQGPPQQGGHPPPPQGRPQGPPQQGGHPRPPRGRPQGPPQQGGHQQGPPP PPPGKPQGPPPQGGRPQGPPQGQSPQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005033 |
| RefSeq Size | 4323 |
| RefSeq ORF | 498 |
| Synonyms | db-s; pa; PIF-S; Pr; pr1/Pr2; PRH1; PRP-1/PRP-2 |
| Locus ID | 5555 |
| Cytogenetics | 12p13.2 |
| Summary | This gene encodes a member of the heterogeneous family of proline-rich salivary glycoproteins. The encoded preproprotein undergoes proteolytic processing to generate one or more mature isoforms before secretion from the parotid and submandibular/sublingual glands. In western population this locus is commonly biallelic and encodes proline-rich protein (PRP) isoforms, PRP-1 and PRP-2. The reference genome encodes the PRP-1 allele. Certain alleles of this gene are associated with susceptibility to dental caries. This gene is located in a cluster of closely related salivary proline-rich proteins on chromosome 12. [provided by RefSeq, Oct 2015] |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417567 | PRH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426314 | PRH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417567 | Transient overexpression lysate of proline-rich protein HaeIII subfamily 2 (PRH2), transcript variant 1 |
CNY 3080.00 |
|
| LY426314 | Transient overexpression lysate of proline-rich protein HaeIII subfamily 2 (PRH2), transcript variant 2 |
CNY 3080.00 |
|
| TP310681 | Recombinant protein of human proline-rich protein HaeIII subfamily 2 (PRH2), transcript variant 1, 20 µg |
CNY 2900.00 |
