GFUS (NM_003313) Human Mass Spec Standard
CAT#: PH310643
TSTA3 MS Standard C13 and N15-labeled recombinant protein (NP_003304)
View other "GFUS" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | TSTA3 MS Standard C13 and N15-labeled recombinant protein (NP_003304) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210643 |
| Predicted MW | 35.9 kDa |
| Protein Sequence |
>RC210643 protein sequence
Red=Cloning site Green=Tags(s) MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLA AMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSN FGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKSSGSALTVWGT GNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQF KKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDNYEQARK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003304 |
| RefSeq Size | 1363 |
| RefSeq ORF | 963 |
| Synonyms | FX; P35B; SDR4E1; TSTA3 |
| Locus ID | 7264 |
| Cytogenetics | 8q24.3 |
| Summary | Tissue specific transplantation antigen P35B is a NADP(H)-binding protein. It catalyze the two-step epimerase and the reductase reactions in GDP-D-mannose metabolism, converting GDP-4-keto-6-D-deoxymannose to GDP-L-fucose. GDP-L-fucose is the substrate of several fucosyltransferases involved in the expression of many glycoconjugates, including blood group ABH antigens and developmental adhesion antigens. Mutations in this gene may cause leukocyte adhesion deficiency, type II. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Amino sugar and nucleotide sugar metabolism, Fructose and mannose metabolism, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418775 | TSTA3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418775 | Transient overexpression lysate of tissue specific transplantation antigen P35B (TSTA3) |
CNY 3080.00 |
|
| TP310643 | Recombinant protein of human tissue specific transplantation antigen P35B (TSTA3), 20 µg |
CNY 2900.00 |
|
| TP720506 | Recombinant protein of human tissue specific transplantation antigen P35B (TSTA3) |
CNY 1800.00 |
