SNX11 (NM_013323) Human Mass Spec Standard
CAT#: PH310611
SNX11 MS Standard C13 and N15-labeled recombinant protein (NP_037455)
View other "SNX11" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | SNX11 MS Standard C13 and N15-labeled recombinant protein (NP_037455) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210611 |
| Predicted MW | 30.4 kDa |
| Protein Sequence |
>RC210611 protein sequence
Red=Cloning site Green=Tags(s) MGFWCRMSENQEQEEVITVRVQDPRVQNEGSWNSYVDYKIFLHTNSKAFTAKTSCVRRRYREFVWLRKQL QRNAGLVPVPELPGKSTFFGTSDEFIEKRRQGLQHFLEKVLQSVVLLSDSQLHLFLQSQLSVPEIEACVQ GRSTMTVSDAILRYAMSNCGWAQEERQSSSHLAKGDQPKSCCFLPRSGRRSSPSPPPSEEKDHLEVWAPV VDSEVPSLESPTLPPLSSPLCCDFGRPKEGTSTLQSVRRAVGGDHAVPLDPGQLETVLEK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_037455 |
| RefSeq Size | 2315 |
| RefSeq ORF | 810 |
| Locus ID | 29916 |
| Cytogenetics | 17q21.32 |
| Summary | This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like some family members. This gene encodes a protein of unknown function. This gene results in two transcript variants differing in the 5' UTR, but encoding the same protein. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407675 | SNX11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC415626 | SNX11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY407675 | Transient overexpression lysate of sorting nexin 11 (SNX11), transcript variant 1 |
CNY 3080.00 |
|
| LY415626 | Transient overexpression lysate of sorting nexin 11 (SNX11), transcript variant 2 |
CNY 3080.00 |
|
| PH300906 | SNX11 MS Standard C13 and N15-labeled recombinant protein (NP_689450) |
CNY 19520.00 |
|
| TP300906 | Recombinant protein of human sorting nexin 11 (SNX11), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP310611 | Recombinant protein of human sorting nexin 11 (SNX11), transcript variant 2, 20 µg |
CNY 2900.00 |
