ARFRP1 (NM_003224) Human Mass Spec Standard
CAT#: PH310518
ARFRP1 MS Standard C13 and N15-labeled recombinant protein (NP_003215)
View other "ARFRP1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | ARFRP1 MS Standard C13 and N15-labeled recombinant protein (NP_003215) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210518 |
| Predicted MW | 22.6 kDa |
| Protein Sequence |
>RC210518 protein sequence
Red=Cloning site Green=Tags(s) MYTLLSGLYKYMFQKDEYCILILGLDNAGKTTFLEQSKTRFNKNYKGMSLSKITTTVGLNIGTVDVGKAR LMFWDLGGQEELQSLWDKYYAECHGVIYVIDSTDEERLAESKQAFEKVVTSEALCGVPVLVLANKQDVET CLSIPDIKTAFSDCTSKIGRRDCLTQACSALTGKGVREGIEWMVKCVVRNVHRPPRQRDIT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003215 |
| RefSeq Size | 2571 |
| RefSeq ORF | 603 |
| Synonyms | ARL18; ARP; Arp1 |
| Locus ID | 10139 |
| Cytogenetics | 20q13.33 |
| Summary | The protein encoded by this gene is a membrane-associated GTP-ase which localizes to the plasma membrane and is related to the ADP-ribosylation factor (ARF) and ARF-like (ARL) proteins. This gene plays a role in membrane trafficking between the trans-Golgi network and endosomes. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, May 2012] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418821 | ARFRP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427485 | ARFRP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418821 | Transient overexpression lysate of ADP-ribosylation factor related protein 1 (ARFRP1), transcript variant 1 |
CNY 3080.00 |
|
| LY427485 | Transient overexpression lysate of ADP-ribosylation factor related protein 1 (ARFRP1), transcript variant 2 |
CNY 3080.00 |
|
| TP310518 | Recombinant protein of human ADP-ribosylation factor related protein 1 (ARFRP1), transcript variant 1, 20 µg |
CNY 2900.00 |
