ARL13B (NM_144996) Human Mass Spec Standard
CAT＃: PH310490
ARL13B MS Standard C13 and N15-labeled recombinant protein (NP_659433)
View other "ARL13B" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
热销推荐Specifications
| Product Data | |
| Description | ARL13B MS Standard C13 and N15-labeled recombinant protein (NP_659433) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210490 |
| Predicted MW | 36.8 kDa |
| Protein Sequence |
>RC210490 protein sequence
Red=Cloning site Green=Tags(s) MFSLMASCCGWFKRWREPVRLANKQDKEGALGEADVIECLSLEKLVNEHKCLCQIEPCSAISGYGKKIDK SIKKGLYWLLHVIARDFDALNERIQKETTEQRALEEQEKQERAERVRKLREERKQNEQEQAELDGTSGLA ELDPEPTNPFQPIASVIIENEGKLEREKKNQKMEKDSDGCHLKHKMEHEQIETQGQVNHNGQKNNEFGLV ENYKEALTQQLKNEDETDRPSLESANGKKKTKKLRMKRNHRVEPLNIDDCAPESPTPPPPPPPVGWGTPK VTRLPKLEPLGETHHNDFYRKPLPPLAVPQRPNSDAHDVIS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_659433 |
| RefSeq Size | 3670 |
| RefSeq ORF | 963 |
| Synonyms | ARL2L1; JBTS8 |
| Locus ID | 200894 |
| Cytogenetics | 3q11.1-q11.2 |
| Summary | This gene encodes a member of the ADP-ribosylation factor-like family. The encoded protein is a small GTPase that contains both N-terminal and C-terminal guanine nucleotide-binding motifs. This protein is localized in the cilia and plays a role in cilia formation and in maintenance of cilia. Mutations in this gene are the cause of Joubert syndrome 8. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405389 | ARL13B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC408134 | ARL13B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432892 | ARL13B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405389 | Transient overexpression lysate of ADP-ribosylation factor-like 13B (ARL13B), transcript variant 1 |
CNY 4840.00 |
|
| LY408134 | Transient overexpression lysate of ADP-ribosylation factor-like 13B (ARL13B), transcript variant 2 |
CNY 3080.00 |
|
| LY432892 | Transient overexpression lysate of ADP-ribosylation factor-like 13B (ARL13B), transcript variant 4 |
CNY 3080.00 |
|
| PH321949 | ARL13B MS Standard C13 and N15-labeled recombinant protein (NP_878899) |
CNY 19520.00 |
|
| TP310490 | Recombinant protein of human ADP-ribosylation factor-like 13B (ARL13B), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP321949 | Recombinant protein of human ADP-ribosylation factor-like 13B (ARL13B), transcript variant 1, 20 µg |
CNY 2900.00 |
