ANKRD2 (NM_020349) Human Mass Spec Standard
CAT＃: PH310468
ANKRD2 MS Standard C13 and N15-labeled recombinant protein (NP_065082)
View other "ANKRD2" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | ANKRD2 MS Standard C13 and N15-labeled recombinant protein (NP_065082) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210468 |
| Predicted MW | 39.9 kDa |
| Protein Sequence |
>RC210468 protein sequence
Red=Cloning site Green=Tags(s) MAKAPSWAGVGALAYKAPEALWPAEAVMDGTMEDSEAVQRATALIEQRLAQEEENEKLRGDARQKLPMDL LVLEDEKHHGAQSAALQKVKGQERVRKTSLDLRREIIDVGGIQNLIELRKKRKQKKRDALAASHEPPPEP EEITGPVDEETFLKAAVEGKMKVIEKFLADGGSADTCDQFRRTALHRASLEGHMEILEKLLDNGATVDFQ DRLDCTAMHWACRGGHLEVVKLLQSHGADTNVRDKLLSTPLHVAVRTGQVEIVEHFLSLGLEINARDREG DTALHDAVRLNRYKIIKLLLLHGADMMTKNLAGKTPTDLVQLWQADTRHALEHPEPGAEHNGLEGPNDSG RETPQPVPAQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_065082 |
| RefSeq Size | 1520 |
| RefSeq ORF | 1080 |
| Synonyms | ARPP |
| Locus ID | 26287 |
| Cytogenetics | 10q24.2 |
| Summary | This gene encodes a protein that belongs to the muscle ankyrin repeat protein (MARP) family. A similar gene in rodents is a component of a muscle stress response pathway and plays a role in the stretch-response associated with slow muscle function. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Mar 2014] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412545 | ANKRD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427086 | ANKRD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412545 | Transient overexpression lysate of ankyrin repeat domain 2 (stretch responsive muscle) (ANKRD2), transcript variant 1 |
CNY 3080.00 |
|
| LY427086 | Transient overexpression lysate of ankyrin repeat domain 2 (stretch responsive muscle) (ANKRD2), transcript variant 2 |
CNY 3080.00 |
|
| PH325475 | ANKRD2 MS Standard C13 and N15-labeled recombinant protein (NP_001123453) |
CNY 14250.00 |
|
| TP310468 | Recombinant protein of human ankyrin repeat domain 2 (stretch responsive muscle) (ANKRD2), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP325475 | Purified recombinant protein of Homo sapiens ankyrin repeat domain 2 (stretch responsive muscle) (ANKRD2), transcript variant 2, 20 µg |
CNY 2900.00 |
