GPS2 (NM_004489) Human Mass Spec Standard
CAT#: PH310464
GPS2 MS Standard C13 and N15-labeled recombinant protein (NP_004480)
View other "GPS2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
Product Data | |
Description | GPS2 MS Standard C13 and N15-labeled recombinant protein (NP_004480) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210464 |
Predicted MW | 36.7 kDa |
Protein Sequence |
>RC210464 protein sequence
Red=Cloning site Green=Tags(s) MPALLERPKLSNAMARALHRHIMMERERKRQEEEEVDKMMEQKMKEEQERRKKKEMEERMSLEETKEQIL KLEEKLLALQEEKHQLFLQLKKVLHEEEKRRRKEQSDLTTLTSAAYQQSLTVHTGTHLLSMQGSPGGHNR PGTLMAADRAKQMFGPQVLTTRHYVGSAAAFAGTPEHGQFQGSPGGAYGTAQPPPHYGPTQPAYSPSQQL RAPSAFPAVQYLSQPQPQPYAVHGHFQPTQTGFLQPGGALSLQKQMEHANQQTGFSDSSSLRPMHPQALH PAPGLLASPQLPVQMQPAGKSGFAATSQPGPRLPFIQHSQNPRFYHK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004480 |
RefSeq Size | 1181 |
RefSeq ORF | 981 |
Synonyms | AMF-1 |
Locus ID | 2874 |
Cytogenetics | 17p13.1 |
Summary | This gene encodes a protein involved in G protein-mitogen-activated protein kinase (MAPK) signaling cascades. When overexpressed in mammalian cells, this gene could potently suppress a RAS- and MAPK-mediated signal and interfere with JNK activity, suggesting that the function of this gene may be signal repression. The encoded protein is an integral subunit of the NCOR1-HDAC3 (nuclear receptor corepressor 1-histone deacetylase 3) complex, and it was shown that the complex inhibits JNK activation through this subunit and thus could potentially provide an alternative mechanism for hormone-mediated antagonism of AP1 (activator protein 1) function. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401424 | GPS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401424 | Transient overexpression lysate of G protein pathway suppressor 2 (GPS2) |
CNY 3080.00 |
|
TP310464 | Purified recombinant protein of Homo sapiens G protein pathway suppressor 2 (GPS2), 20 µg |
CNY 2900.00 |