ATP5F1E (NM_006886) Human Mass Spec Standard
CAT#: PH310456
ATP5E MS Standard C13 and N15-labeled recombinant protein (NP_008817)
View other "ATP5F1E" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
Product Data | |
Description | ATP5E MS Standard C13 and N15-labeled recombinant protein (NP_008817) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210456 |
Predicted MW | 5.8 kDa |
Protein Sequence |
>RC210456 protein sequence
Red=Cloning site Green=Tags(s) MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKIVKVKKE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_008817 |
RefSeq Size | 449 |
RefSeq ORF | 153 |
Synonyms | ATP5E; ATPE; MC5DN3 |
Locus ID | 514 |
Cytogenetics | 20q13.32 |
Summary | This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the epsilon subunit of the catalytic core. Two pseudogenes of this gene are located on chromosomes 4 and 13. Read-through transcripts that include exons from this gene are expressed from the upstream gene SLMO2.[provided by RefSeq, Mar 2011] |
Protein Pathways | Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416365 | ATP5E HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416365 | Transient overexpression lysate of ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit (ATP5E), nuclear gene encoding mitochondrial protein |
CNY 3080.00 |
|
TP310456 | Recombinant protein of human ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit (ATP5E), nuclear gene encoding mitochondrial protein, 20 µg |
CNY 2900.00 |
其它ATP5F1E产品