HMG14 (HMGN1) (NM_004965) Human Mass Spec Standard
CAT#: PH310454
HMGN1 MS Standard C13 and N15-labeled recombinant protein (NP_004956)
View other "HMG14" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | HMGN1 MS Standard C13 and N15-labeled recombinant protein (NP_004956) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210454 |
| Predicted MW | 10.7 kDa |
| Protein Sequence |
>RC210454 protein sequence
Red=Cloning site Green=Tags(s) MPKRKVSSTEGAAKEEPKRRSARLSAKPPAKVEANPKKAAAKDKSSDKKVQTKGKRGAKGKQAEVANQET KEDLPAENGETKTEESPASDEAGEKEAKSD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004956 |
| RefSeq Size | 1313 |
| RefSeq ORF | 300 |
| Synonyms | HMG14 |
| Locus ID | 3150 |
| Cytogenetics | 21q22.2 |
| Summary | The protein encoded by this gene binds nucleosomal DNA and is associated with transcriptionally active chromatin. Along with a similar protein, HMG17, the encoded protein may help maintain an open chromatin configuration around transcribable genes. [provided by RefSeq, Aug 2011] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417625 | HMGN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417625 | Transient overexpression lysate of high-mobility group nucleosome binding domain 1 (HMGN1) |
CNY 3080.00 |
|
| TP310454 | Recombinant protein of human high-mobility group nucleosome binding domain 1 (HMGN1), 20 µg |
CNY 2900.00 |
