DSCR4 (NM_005867) Human Mass Spec Standard
CAT#: PH310247
DSCR4 MS Standard C13 and N15-labeled recombinant protein (NP_005858)
View other "DSCR4" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
| Product Data | |
| Description | DSCR4 MS Standard C13 and N15-labeled recombinant protein (NP_005858) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210247 |
| Predicted MW | 13 kDa |
| Protein Sequence |
>RC210247 protein sequence
Red=Cloning site Green=Tags(s) MSLIILTRDDEPRIFTPDSDAASPALHSTSPLPDPASASPLHREEKILPKVCNIVSCLSFSLPASPTDSG LASPTIITREGQQFWAKCLIWKYQLYLHGLHKKSDGRRDKQISASPST myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005858 |
| RefSeq Size | 1102 |
| RefSeq ORF | 354 |
| Synonyms | DCRB; DSCRB |
| Locus ID | 10281 |
| Cytogenetics | 21q22.13 |
| Summary | The gene is found in a region of chromosome 21 that has been linked to the pathogenesis of Down syndrome. This gene is transcribed from a bi-directional promoter located in an endogenous retrovirus. [provided by RefSeq, Jan 2015] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417009 | DSCR4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417009 | Transient overexpression lysate of Down syndrome critical region gene 4 (DSCR4) |
CNY 3080.00 |
|
| TP310247 | Recombinant protein of human Down syndrome critical region gene 4 (DSCR4), 20 µg |
CNY 2900.00 |
