CD200R (CD200R1) (NM_138806) Human Mass Spec Standard
CAT＃: PH310223
CD200R1 MS Standard C13 and N15-labeled recombinant protein (NP_620161)
View other "CD200R" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | CD200R1 MS Standard C13 and N15-labeled recombinant protein (NP_620161) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210223 |
| Predicted MW | 39 kDa |
| Protein Sequence |
>RC210223 protein sequence
Red=Cloning site Green=Tags(s) MLCPWRTANLGLLLILTIFLVAEAEGAAQPNNSLMLQTSKENHALASSSLCMDEKQITQNYSKVLAEVNT SWPVKMATNAVLCCPPIALRNLIIITWEIILRGQPSCTKAYKKETNETKETNCTDERITWVSRPDQNSDL QIRTVAITHDGYYRCIMVTPDGNFHRGYHLQVLVTPEVTLFQNRNRTAVCKAVAGKPAAHISWIPEGDCA TKQEYWSNGTVTVKSTCHWEVHNVSTVTCHVSHLTGNKSLYIELLPVPGAKKSAKLYIPYIILTIIILTI VGFIWLLKVNGCRKYKLNKTESTPVVEEDEMQPYASYTEKNNPLYDTTNKVKASEALQSEVDTDLHTL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_620161 |
| RefSeq Size | 2272 |
| RefSeq ORF | 1044 |
| Synonyms | CD200R; HCRTR2; MOX2R; OX2R |
| Locus ID | 131450 |
| Cytogenetics | 3q13.2 |
| Summary | This gene encodes a receptor for the OX-2 membrane glycoprotein. Both the receptor and substrate are cell surface glycoproteins containing two immunoglobulin-like domains. This receptor is restricted to the surfaces of myeloid lineage cells and the receptor-substrate interaction may function as a myeloid downregulatory signal. Mouse studies of a related gene suggest that this interaction may control myeloid function in a tissue-specific manner. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406878 | CD200R1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC408492 | CD200R1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406878 | Transient overexpression lysate of CD200 receptor 1 (CD200R1), transcript variant 4 |
CNY 3080.00 |
|
| LY408492 | Transient overexpression lysate of CD200 receptor 1 (CD200R1), transcript variant 1 |
CNY 3080.00 |
|
| PH310870 | CD200R1 MS Standard C13 and N15-labeled recombinant protein (NP_740750) |
CNY 19520.00 |
|
| TP310223 | Recombinant protein of human CD200 receptor 1 (CD200R1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP310870 | Recombinant protein of human CD200 receptor 1 (CD200R1), transcript variant 4, 20 µg |
CNY 2900.00 |
|
| TP720280 | Recombinant protein of human CD200 receptor 1 (CD200R1), transcript variant 1 |
CNY 3140.00 |
