FABP2 (NM_000134) Human Mass Spec Standard
CAT#: PH310206
FABP2 MS Standard C13 and N15-labeled recombinant protein (NP_000125)
View other "FABP2" proteins (4)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 19520.00
CNY 3080.00
                                                
                                                
                                                
                                                    CNY 1999.00 
                                                    
                                                    CNY 2700.00
                                                
                                            
Specifications
| Product Data | |
| Description | FABP2 MS Standard C13 and N15-labeled recombinant protein (NP_000125) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC210206 | 
| Predicted MW | 15.2 kDa | 
| Protein Sequence | 
                 >RC210206 protein sequence 
Red=Cloning site Green=Tags(s) MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFN YNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_000125 | 
| RefSeq Size | 2271 | 
| RefSeq ORF | 396 | 
| Synonyms | FABPI; I-FABP | 
| Locus ID | 2169 | 
| Cytogenetics | 4q26 | 
| Summary | The protein encoded by this gene is an intracellular fatty acid-binding protein that participates in the uptake, intracellular metabolism, and transport of long-chain fatty acids. The encoded protein is also involved in the modulation of cell growth and proliferation. This protein binds saturated long-chain fatty acids with high affinity, and may act as a lipid sensor to maintain energy homeostasis. [provided by RefSeq, Aug 2017] | 
| Protein Pathways | PPAR signaling pathway | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC424906 | FABP2 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY424906 | Transient overexpression lysate of fatty acid binding protein 2, intestinal (FABP2) | 
                                                     CNY 3080.00  | 
                                            |
| TP310206 | Recombinant protein of human fatty acid binding protein 2, intestinal (FABP2), 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            |
| TP720115 | Recombinant protein of human fatty acid binding protein 2, intestinal (FABP2) | 
                                                     CNY 1800.00  | 
                                            
