CELA2B (NM_015849) Human Mass Spec Standard
CAT#: PH310126
CELA2B MS Standard C13 and N15-labeled recombinant protein (NP_056933)
View other "CELA2B" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
Product Data | |
Description | CELA2B MS Standard C13 and N15-labeled recombinant protein (NP_056933) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210126 |
Predicted MW | 28.8 kDa |
Protein Sequence |
>RC210126 protein sequence
Red=Cloning site Green=Tags(s) MIRTLLLSTLVAGALSCGVSTYAPDMSRMLGGEEARPNSWPWQVSLQYSSNGQWYHTCGGSLIANSWVLT AAHCISSSGIYRVMLGQHNLYVAESGSLAVSVSKIVVHKDWNSDQVSKGNDIALLKLANPVSLTDKIQLA CLPPAGTILPNNYPCYVTGWGRLQTNGALPDDLKQGRLLVVDYATCSSSGWWGSTVKTNMICAGGDGVIC TCNGDSGGPLNCQASDGRWEVHGIGSLTSVLGCNYYYKPSIFTRVSNYNDWINSVIANN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_056933 |
RefSeq Size | 941 |
RefSeq ORF | 807 |
Synonyms | ELA2B |
Locus ID | 51032 |
Cytogenetics | 1p36.21 |
Summary | Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode the structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Like most of the human elastases, elastase 2B is secreted from the pancreas as a zymogen. In other species, elastase 2B has been shown to preferentially cleave proteins after leucine, methionine, and phenylalanine residues. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414375 | CELA2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414375 | Transient overexpression lysate of chymotrypsin-like elastase family, member 2B (CELA2B) |
CNY 3080.00 |
|
TP310126 | Recombinant protein of human elastase 2B (ELA2B), 20 µg |
CNY 2900.00 |