ABH2 (ALKBH2) (NM_001001655) Human Mass Spec Standard
CAT#: PH310103
ALKBH2 MS Standard C13 and N15-labeled recombinant protein (NP_001001655)
View other "ABH2" proteins (11)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | ALKBH2 MS Standard C13 and N15-labeled recombinant protein (NP_001001655) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210103 |
Predicted MW | 29.3 kDa |
Protein Sequence |
>RC210103 protein sequence
Red=Cloning site Green=Tags(s) MDRFLVKGAQGGLLRKQEEQEPTGEEPAVLGGDKESTRKRPRREAPGNGGHSAGPSWRHIRAEGLDCSYT VLFGKAEADEIFQELEKEVEYFTGALARVQVFGKWHSVPRKQATYGDAGLTYTFSGLTLSPKPWIPVLER IRDHVSGVTGQTFNFVLINRYKDGCDHIGEHRDDERELAPGSPIASVSFGACRDFVFRHKDSRGKSPSRR VAVVRLPLAHGSLLMMNHPTNTHWYHSLPVRKKVLAPRVNLTFRKILLTKK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001001655 |
RefSeq Size | 1056 |
RefSeq ORF | 783 |
Synonyms | ABH2 |
Locus ID | 121642 |
Cytogenetics | 12q24.11 |
Summary | The Escherichia coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific DNA lesions generated in single-stranded DNA. ALKBH2 and ALKBH3 (MIM 610603) are E. coli AlkB homologs that catalyze the removal of 1-methyladenine and 3-methylcytosine (Duncan et al., 2002 [PubMed 12486230]).[supplied by OMIM, Mar 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400362 | ALKBH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428853 | ALKBH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428854 | ALKBH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400362 | Transient overexpression lysate of alkB, alkylation repair homolog 2 (E. coli) (ALKBH2), transcript variant 2 |
CNY 3080.00 |
|
LY428853 | Transient overexpression lysate of alkB, alkylation repair homolog 2 (E. coli) (ALKBH2), transcript variant 1 |
CNY 3080.00 |
|
LY428854 | Transient overexpression lysate of alkB, alkylation repair homolog 2 (E. coli) (ALKBH2), transcript variant 3 |
CNY 3080.00 |
|
PH326507 | ALKBH2 MS Standard C13 and N15-labeled recombinant protein (NP_001138846) |
CNY 19520.00 |
|
PH326527 | ALKBH2 MS Standard C13 and N15-labeled recombinant protein (NP_001138847) |
CNY 19520.00 |
|
TP310103 | Recombinant protein of human alkB, alkylation repair homolog 2 (E. coli) (ALKBH2), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP326507 | Recombinant protein of human alkB, alkylation repair homolog 2 (E. coli) (ALKBH2), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP326527 | Recombinant protein of human alkB, alkylation repair homolog 2 (E. coli) (ALKBH2), transcript variant 3, 20 µg |
CNY 2900.00 |