TSC22D3 (NM_004089) Human Mass Spec Standard
CAT#: PH310088
TSC22D3 MS Standard C13 and N15-labeled recombinant protein (NP_004080)
View other "TSC22D3" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | TSC22D3 MS Standard C13 and N15-labeled recombinant protein (NP_004080) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210088 |
| Predicted MW | 14.8 kDa |
| Protein Sequence |
>RC210088 protein sequence
Red=Cloning site Green=Tags(s) MNTEMYQTPMEVAVYQLHNFSISFFSSLLGGDVVSVKLDNSASGASVVAIDNKIEQAMDLVKNHLMYAVR EEVEILKEQIRELVEKNSQLERENTLLKTLASPEQLEKFQSCLSPEEPAPESPQVPEAPGGSAV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004080 |
| RefSeq Size | 1986 |
| RefSeq ORF | 402 |
| Synonyms | DIP; DSIPI; GILZ; TSC-22R |
| Locus ID | 1831 |
| Cytogenetics | Xq22.3 |
| Summary | This gene encodes the anti-inflammatory protein glucocorticoid (GC)-induced leucine zipper. Expression of this gene stimulated by glucocorticoids and interleukin 10 and it appears to play a key role in the anti-inflammatory and immunosuppressive effects of this steroid. This protein has also been shown to inhibit pro-inflammatory molecules including nuclear factor κB. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418232 | TSC22D3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418232 | Transient overexpression lysate of TSC22 domain family, member 3 (TSC22D3), transcript variant 2 |
CNY 3080.00 |
|
| TP310088 | Recombinant protein of human TSC22 domain family, member 3 (TSC22D3), transcript variant 2, 20 µg |
CNY 2900.00 |
其它TSC22D3产品
