PTRHD1 (NM_001013663) Human Mass Spec Standard
CAT#: PH310056
C2orf79 MS Standard C13 and N15-labeled recombinant protein (NP_001013685)
View other "PTRHD1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
Product Data | |
Description | C2orf79 MS Standard C13 and N15-labeled recombinant protein (NP_001013685) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210056 |
Predicted MW | 15.6 kDa |
Protein Sequence |
>RC210056 representing NM_001013663
Red=Cloning site Green=Tags(s) MHRGVGPAFRVVRKMAASGAEPQVLVQYLVLRKDLSQAPFSWPAGALVAQACHAATAALHTHRDHPHTAA YLQELGRMRKVVLEAPDETTLKELAETLQQKNIDHMLWLEQPENIATCIALRPYPKEEVGQYLKKFRLFK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001013685 |
RefSeq Size | 602 |
RefSeq ORF | 420 |
Synonyms | C2orf79 |
Locus ID | 391356 |
Cytogenetics | 2p23.3 |
Summary | This gene encodes the enzyme peptidyl-tRNA hydrolase. Peptidyl-tRNA hydrolases perform the essential function of recycling peptidyl-tRNAs. Mutations in this gene are associated with autosomal-recessive intellectual disability and parkinsonism. [provided by RefSeq, May 2017] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC423012 | PTRHD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY423012 | Transient overexpression lysate of chromosome 2 open reading frame 79 (C2orf79) |
CNY 3080.00 |
|
TP310056 | Recombinant protein of human chromosome 2 open reading frame 79 (C2orf79), 20 µg |
CNY 2900.00 |