PPM1F (NM_014634) Human Mass Spec Standard
CAT#: PH310043
PPM1F MS Standard C13 and N15-labeled recombinant protein (NP_055449)
View other "PPM1F" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PPM1F MS Standard C13 and N15-labeled recombinant protein (NP_055449) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210043 |
| Predicted MW | 49.7 kDa |
| Protein Sequence |
>RC210043 protein sequence
Red=Cloning site Green=Tags(s) MSSGAPQKSSPMASGAEETPGFLDTLLQDFPALLNPEDPLPWKAPGTVLSQEEVEGELAELAMGFLGSRK APPPLAAALAHEAVSQLLQTDLSEFRKLPREEEEEEEDDDEEKAPVTLLDAQSLAQSFFNRLWEVAGQWQ KQVPLAARASQRQWLVSIHAIRNTRRKMEDRHVSLPSFNQLFGLSDPVNRAYFAVFDGHGGVDAARYAAV HVHTNAARQPELPTDPEGALREAFRRTDQMFLRKAKRERLQSGTTGVCALIAGATLHVAWLGDSQVILVQ QGQVVKLMEPHRPERQDEKARIEALGGFVSHMDCWRVNGTLAVSRAIGDVFQKPYVSGEADAASRALTGS EDYLLLACDGFFDVVPHQEVVGLVQSHLTRQQGSGLRVAEELVAAARERGSHDNITVMVVFLRDPQELLE GGNQGEGDPQAEGRRQDLPSSLPEPETQAPPRS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_055449 |
| RefSeq Size | 5199 |
| RefSeq ORF | 1359 |
| Synonyms | CAMKP; CaMKPase; FEM-2; hFEM-2; POPX2 |
| Locus ID | 9647 |
| Cytogenetics | 22q11.22 |
| Summary | The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase can interact with Rho guanine nucleotide exchange factors (PIX), and thus block the effects of p21-activated kinase 1 (PAK), a protein kinase mediating biological effects downstream of Rho GTPases. Calcium/calmodulin-dependent protein kinase II gamma (CAMK2G/CAMK-II) is found to be one of the substrates of this phosphatase. The overexpression of this phosphatase or CAMK2G has been shown to mediate caspase-dependent apoptosis. An alternatively spliced transcript variant has been identified, but its full-length nature has not been determined. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Phosphatase |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402357 | PPM1F HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402357 | Transient overexpression lysate of protein phosphatase 1F (PP2C domain containing) (PPM1F) |
CNY 3080.00 |
|
| TP310043 | Recombinant protein of human protein phosphatase 1F (PP2C domain containing) (PPM1F), 20 µg |
CNY 2900.00 |
