PIGH (NM_004569) Human Mass Spec Standard
CAT#: PH310028
PIGH MS Standard C13 and N15-labeled recombinant protein (NP_004560)
View other "PIGH" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PIGH MS Standard C13 and N15-labeled recombinant protein (NP_004560) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210028 |
| Predicted MW | 21.1 kDa |
| Protein Sequence |
>RC210028 protein sequence
Red=Cloning site Green=Tags(s) MEDERSFSDICGGRLALQRRYYSPSCREFCLSCPRLSLRSLTAVTCTVWLAAYGLFTLCENSMILSAAIF ITLLGLLGYLHFVKIDQETLLIIDSLGIQMTSSYASGKESTTFIEMGKVKDIVINEAIYMQKVIYYLCIL LKDPVEPHGISQVVPVFQSAKPRLDCLIEVYRSCQEILAHQKATSTSP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004560 |
| RefSeq Size | 1439 |
| RefSeq ORF | 564 |
| Synonyms | GPI-H |
| Locus ID | 5283 |
| Cytogenetics | 14q24.1 |
| Summary | This gene encodes an endoplasmic reticulum associated protein that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI anchor is a glycolipid found on many blood cells and which serves to anchor proteins to the cell surface. The protein encoded by this gene is a subunit of the GPI N-acetylglucosaminyl (GlcNAc) transferase that transfers GlcNAc to phosphatidylinositol (PI) on the cytoplasmic side of the endoplasmic reticulum. [provided by RefSeq, Jul 2008] |
| Protein Families | Transmembrane |
| Protein Pathways | Glycosylphosphatidylinositol(GPI)-anchor biosynthesis, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417898 | PIGH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417898 | Transient overexpression lysate of phosphatidylinositol glycan anchor biosynthesis, class H (PIGH) |
CNY 3080.00 |
|
| TP310028 | Recombinant protein of human phosphatidylinositol glycan anchor biosynthesis, class H (PIGH), 20 µg |
CNY 2900.00 |
