CCL3 (NM_002983) Human Mass Spec Standard
CAT#: PH310026
CCL3 MS Standard C13 and N15-labeled recombinant protein (NP_002974)
View other "CCL3" proteins (5)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 19520.00
Specifications
| Product Data | |
| Description | CCL3 MS Standard C13 and N15-labeled recombinant protein (NP_002974) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC210026 | 
| Predicted MW | 10.1 kDa | 
| Protein Sequence | 
                 >RC210026 protein sequence 
Red=Cloning site Green=Tags(s) MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSR QVCADPSEEWVQKYVSDLELSA myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_002974 | 
| RefSeq Size | 813 | 
| RefSeq ORF | 276 | 
| Synonyms | G0S19-1; LD78ALPHA; MIP-1-alpha; MIP1A; SCYA3 | 
| Locus ID | 6348 | 
| Cytogenetics | 17q12 | 
| Summary | This locus represents a small inducible cytokine. The encoded protein, also known as macrophage inflammatory protein 1 alpha, plays a role in inflammatory responses through binding to the receptors CCR1, CCR4 and CCR5. Polymorphisms at this locus may be associated with both resistance and susceptibility to infection by human immunodeficiency virus type 1.[provided by RefSeq, Sep 2010] | 
| Protein Families | Druggable Genome, Secreted Protein | 
| Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction, Toll-like receptor signaling pathway | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC418970 | CCL3 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY418970 | Transient overexpression lysate of chemokine (C-C motif) ligand 3 (CCL3) | 
                                                     CNY 3080.00  | 
                                            |
| TP310026 | Recombinant protein of human chemokine (C-C motif) ligand 3 (CCL3), 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            |
| TP720049 | Recombinant protein of human chemokine (C-C motif) ligand 3 (CCL3) | 
                                                     CNY 1800.00  | 
                                            |
| TP790113 | Purified recombinant protein of Human chemokine (C-C motif) ligand 3 (CCL3), esidues 24-92aa, with N-terminal His tag, secretory expressed in HEK293 cells, 50ug | 
                                                     CNY 6650.00  | 
                                            
