OSTM1 (NM_014028) Human Mass Spec Standard
CAT#: PH309871
OSTM1 MS Standard C13 and N15-labeled recombinant protein (NP_054747)
View other "OSTM1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | OSTM1 MS Standard C13 and N15-labeled recombinant protein (NP_054747) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209871 |
Predicted MW | 37.3 kDa |
Protein Sequence |
>RC209871 protein sequence
Red=Cloning site Green=Tags(s) MEPGPTAAQRRCSLPPWLPLGLLLWSGLALGALPFGSSPHRVFHDLLSEQQLLEVEDLSLSLLQGGGLGP LSLPPDLPDLDPECRELLLDFANSSAELTGCLVRSARPVRLCQTCYPLFQQVVSKMDNISRAAGNTSESQ SCARSLLMADRMQIVVILSEFFNTTWQEANCANCLTNNSEELSNSTVYFLNLFNHTLTCFEHNLQGNAHS LLQTKNYSEVCKNCREAYKTLSSLYSEMQKMNELENKAEPGTHLCIDVEDAMNITRKLWSRTFNCSVPCS DTVPVIAVSVFILFLPVVFYLSSFLHSEQKKRKLILPKRLKSSTSFANIQENSN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_054747 |
RefSeq Size | 4467 |
RefSeq ORF | 1002 |
Synonyms | GIPN; GL; HSPC019; OPTB5 |
Locus ID | 28962 |
Cytogenetics | 6q21 |
Summary | This gene encodes a protein that may be involved in the degradation of G proteins via the ubiquitin-dependent proteasome pathway. The encoded protein binds to members of subfamily A of the regulator of the G-protein signaling (RGS) family through an N-terminal leucine-rich region. This protein also has a central RING finger-like domain and E3 ubiquitin ligase activity. This protein is highly conserved from flies to humans. Defects in this gene may cause the autosomal recessive, infantile malignant form of osteopetrosis. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402271 | OSTM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402271 | Transient overexpression lysate of osteopetrosis associated transmembrane protein 1 (OSTM1) |
CNY 3080.00 |
|
TP309871 | Recombinant protein of human osteopetrosis associated transmembrane protein 1 (OSTM1), 20 µg |
CNY 2900.00 |