YB1 (YBX1) (NM_004559) Human Mass Spec Standard
CAT#: PH309835
YBX1 MS Standard C13 and N15-labeled recombinant protein (NP_004550)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | YBX1 MS Standard C13 and N15-labeled recombinant protein (NP_004550) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC209835 |
| Predicted MW | 35.9 kDa |
| Protein Sequence |
>RC209835 protein sequence
Red=Cloning site Green=Tags(s) MSSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGDKKVIATKVLGTVKWFNVRN GYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAA DRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRRPYGRRPQYSN PPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRR YRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQGGAE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004550 |
| RefSeq Size | 1561 |
| RefSeq ORF | 972 |
| Synonyms | BP-8; CBF-A; CSDA2; CSDB; DBPB; EFI-A; MDR-NF1; NSEP-1; NSEP1; YB-1; YB1 |
| Locus ID | 4904 |
| Cytogenetics | 1p34.2 |
| Summary | This gene encodes a highly conserved cold shock domain protein that has broad nucleic acid binding properties. The encoded protein functions as both a DNA and RNA binding protein and has been implicated in numerous cellular processes including regulation of transcription and translation, pre-mRNA splicing, DNA reparation and mRNA packaging. This protein is also a component of messenger ribonucleoprotein (mRNP) complexes and may have a role in microRNA processing. This protein can be secreted through non-classical pathways and functions as an extracellular mitogen. Aberrant expression of the gene is associated with cancer proliferation in numerous tissues. This gene may be a prognostic marker for poor outcome and drug resistance in certain cancers. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on multiple chromosomes. [provided by RefSeq, Sep 2015] |
| Protein Families | ES Cell Differentiation/IPS, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417905 | YBX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417905 | Transient overexpression lysate of Y box binding protein 1 (YBX1) |
CNY 3080.00 |
|
| TP309835 | Purified recombinant protein of Homo sapiens Y box binding protein 1 (YBX1), 20 µg |
CNY 2900.00 |


